Sign In | Join Free | My
Search by Category
Home > Chemicals > Amine >

Find Synonyms

1-10 Results for

find synonyms

from 100080 Products

99% Purity DHB Injectable Anabolic Steroid 1-Testosterone Powder

China 99% Purity DHB Injectable Anabolic Steroid 1-Testosterone Powder on sale
99% Purity DHB Injectable Anabolic Steroid 1-Testosterone Powder Keywords: 1-testosterone cypionate, DHB, 1-testosterone, injectale steroid, lean muscle gains, dhb powder 1-testosterone (dihydroboldenone), or DHB for short, is an anabolic steroid that has......
Shenzhen Shijingu Technology Co., Ltd.

Address: Shenzhen China

99%Min Assay Sex Steroid Hormones Hydrochloride 119356-77-3 341.88 Molecular Weight

China 99%Min Assay Sex Steroid Hormones  Hydrochloride 119356-77-3 341.88 Molecular Weight on sale
...99%Min Assay Sex Steroid Hormones Hydrochloride 119356-77-3 341.88 Molecular Weight Synonyms: DAPOXETIN; CAS No.: 119356-77-3 Molecular Weight: 341.88 Molecular Formula: C21H23NO HCL Assay: 99%......

Address: #201, Zhangzhidong Road, Wuchang, Wuhan

Methyltrienolone Powder Oral Trenbolone Steroid Metribolone / Methyltrienolone For Fat Loss

China Methyltrienolone Powder Oral Trenbolone Steroid Metribolone / Methyltrienolone For Fat Loss on sale
... Co.,LTD Contact person: Miss Yvonne Mail: whatsapp:+86 18872220653 1. Methyltrienolone Details: Synonyms METRIBOLONE,Metribolone CAS 965-93-5 MF C19H24O2 MW 284.39 Assay 99% min. Packing foil......
Wuhan Lianshangwang Technology Co.,LTD

Address: No.52 Jinkou ,Jiangxia district , Wuhan, Hubei, China

High Purity Dutasteride Avodart for Bodybuilding CAS:164656-23-9

China High Purity Dutasteride Avodart for Bodybuilding CAS:164656-23-9 on sale
...High Purity Dutasteride Avodart for Bodybuilding CAS:164656-23-9 Basic info: Dutasteride Synonyms: (5alpha, 17beta)-n-{2, 5-bis(trifluoromethyl)phenyl}-3-oxo-4-azaandrost-l-ene-17-carboxamide; DUTASTERIDE; (5A, 17)-N-[2, 5-Bis(trifluoromethyl)......
Guangzhou Kafen Biotech Co.,Ltd

Address: No.128,Hanxing East Rd,Zhongcun,Panyu District,Guangzhou,Guangdong,China

Antineoplastic Steroid Powder Exemestane Aromasin CAS 107868-30-4

China Antineoplastic Steroid Powder Exemestane Aromasin CAS 107868-30-4 on sale
...Antineoplastic Steroid Powder Exemestane Aromasin CAS 107868-30-4 Quick Detail Product Name Exemestane Synonym Aromasin;Exemestan;Exemestane CAS 107868-30-4 MF C20H24O2 MW 296.4 Melting Point 155.13°C Solubility ......
Jinan  Jia  Ge  Biological  Technology  Co., Ltd.

Address: #18 Sankongqiao Road, Tianqiao Area, Jinan City, Shandong Province, China

Looks Synonymous With Clay Roof Tile Bamboo Synthetic Resin Roof Tile

China Looks Synonymous With Clay Roof Tile Bamboo Synthetic Resin Roof Tile on sale
... Clay Roof Tile Bamboo Synthetic Resin Roof Tile Often looks synonymous with clay roof tile, Roma roof sheet enhances virtually any of architecture from small bungalows ......
Foshan Yiquan Plastic Building Material Co.Ltd

Address: Gaohai Industrial Park, Jinsha, Nanhai District

Pharmaceutical Raw Powder Danofloxacin Mesylate CAS: 119478-55-6 With Factory Direct Supplying

China Pharmaceutical Raw Powder Danofloxacin Mesylate CAS: 119478-55-6 With Factory Direct Supplying on sale
Pharmaceutical Raw Powder Danofloxacin Mesylate CAS: 119478-55-6 With Factory Direct Supplying Certification ISO9001 Place of Origin :China Minimum Order Quantity :10 Gram Payment Terms :T/T, Western Union, MoneyGram Supply Ability :500-1000KG Per Month ......
Hongkong YuanCheng GongChuang Technology Co.,Ltd

Address: Flat C 4/F Civic Comm Bldg, 165-167 Woosung St Kln, Hong Kong

Muscle Growth Steroids Powder, Metribolone / Methyltrienolone 965-93-5 for Bulking Cycle

China Muscle Growth Steroids Powder,  Metribolone / Methyltrienolone 965-93-5 for Bulking Cycle on sale
Muscle Growth Steroids Powder, Metribolone / Methyltrienolone 965-93-5 for Bulking Cycle MOQ: 10g Shipping cost: $560 Buy 100g get 10g Buy 1kg get 100g Payment: T/T, Western Union, MoneyGram, Bitcoin Shipping Method: HKEMS, DHL, TNT, ETK, Fedex etc Lesley......
Shenzhen Sendi Biotechnology Co.Ltd.

Address: 306 Xinsha Road, Shajing Street, Bao'an District,Shenzhen, Guangdong, China

GHRP6 GHRP-6 99% purity Peptides Steroids for Weight Loss Polypetide Hormones 2mg / Vial 87616-84-0

China GHRP6 GHRP-6 99% purity Peptides Steroids for Weight Loss Polypetide Hormones 2mg / Vial 87616-84-0 on sale
TOP Ghrp-6 99% purity Peptides Ghrp-6 for Weight Loss ​2mg/Vial 87616-84-0 Polypetide Hormones GHRP-6, also known as Releasing Hexapeptide, is a peptide hormone of the hormone class. As is with all related peptides, GHRP-6 is widely used to increase the......
JCJ Logis Co.,ltd

Address: Qianjia Road ,Wuhan City ,Hubei Province, China

CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0

China CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 on sale
... With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl......
Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd

Address: No.388, Huangshan Road, Tianyuan District, Zhuzhou, Hunan, P.R.China.

Submit your find synonyms inquiry in a minute :
Your email address is incorrect!

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd

Products: CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0

Your subject must be between 10-255 characters!
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000 characters!
Please reply me within 24 hours.
Yes! I would like your verified suppliers matching service!
Yes! If this supplier doesn't contact me in 3 days, I want to recommend me more suppliers.
Submit find synonyms inquiry
Your email address is incorrect!
Your subject must be between 10-255 characters!
For the best results, we recommend including the following details:
  • --Self introduction
  • --Required specifications
  • --Inquire about price/MOQ
Your message must be between 20-3,000
Yes! I would like your verified suppliers matching service!
Inquiry Cart 0