Sign In | Join Free | My xxjcy.com
xxjcy.com
Products
Search by Category

synonyms and synonyms

All synonyms and synonyms wholesalers & synonyms and synonyms manufacturers come from members. We doesn't provide synonyms and synonyms products or service, please contact them directly and verify their companies info carefully.

Total 100026 products from synonyms and synonyms Manufactures & Suppliers
Buy cheap Looks Synonymous With Clay Roof Tile Bamboo Synthetic Resin Roof Tile product

Brand Name:Yiquan

Model Number:Y1050-031

Place of Origin:China

...Looks Synonymous With Clay Roof Tile Bamboo Synthetic Resin Roof Tile Often looks synonymous with clay roof tile, Roma roof sheet enhances virtually any of architecture from small bungalows ...

Foshan Yiquan Plastic Building Material Co.Ltd
Verified Supplier

Buy cheap Pharmaceutical Raw Materials F9 Meropenem Intermediate Powder For Synthesis of Meropenem product

Brand Name:SBJ

Model Number:137391-68-5

Place of Origin:China

... coco@yuanchengtech.com whatsapp:+86 18872220806 Meropenem Intermediate F-9 Details: Product name Meropenem intermediates F9 Synonyms (3S, 4R)-3-[(1R)-1-Hydroxyethyl]-4-[(1R)-1-methyl-3-diazo-3-(p-nitrobenzyloxycarbonyl)-2-oxopropyl]azetidin-2-one CAS No...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Buy cheap Antineoplastic Steroid Powder Exemestane Aromasin CAS 107868-30-4 product

Brand Name:JNJG

Model Number:107868-30-4

Place of Origin:CHINA

...Antineoplastic Steroid Powder Exemestane Aromasin CAS 107868-30-4 Quick Detail Product Name Exemestane Synonym Aromasin;Exemestan;Exemestane CAS 107868-30-4 MF C20H24O2 MW 296.4 Melting Point 155.13°C Solubility ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Buy cheap White crystalline powder L (-) -Epinephrine Supplier/51-43-4/Pharmaceutical Intermediate product

Brand Name:steriodshow

Model Number:51-43-4

Place of Origin:china manufactuer

...Product Description Epinephrine Product name: L(-)-Epinephrine L(-)-Epinephrine Synonyms: (R) - epinephrine; 1- (3,4-dihydroxyphenyl) -2-aminoethanol; 3,4-dihydroxy -α- (methylaminomethyl) benzyl alcohol; adrenal base ; adrenalin; adrenalin; L-3,4- ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Pharmaceutical Raw Powder Danofloxacin Mesylate CAS: 119478-55-6 With Factory Direct Supplying product

Brand Name:HKYC

Model Number:119478-55-6

Place of Origin:HUBEI,CHINA

Pharmaceutical Raw Powder Danofloxacin Mesylate CAS: 119478-55-6 With Factory Direct Supplying Certification ISO9001 Place of Origin :China Minimum Order Quantity :10 Gram Payment Terms :T/T, Western Union, MoneyGram Supply Ability :500-1000KG Per Month ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap Muscle Growth Steroids Powder,  Metribolone / Methyltrienolone 965-93-5 for Bulking Cycle product

Brand Name:Sendi

Model Number:Metribolone

Place of Origin:China

Muscle Growth Steroids Powder, Metribolone / Methyltrienolone 965-93-5 for Bulking Cycle MOQ: 10g Shipping cost: $560 Buy 100g get 10g Buy 1kg get 100g Payment: T/T, Western Union, MoneyGram, Bitcoin Shipping Method: HKEMS, DHL, TNT, ETK, Fedex etc Lesley...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap GHRP6 GHRP-6 99% purity Peptides Steroids for Weight Loss Polypetide Hormones 2mg / Vial 87616-84-0 product

Brand Name:GHRP-6

Model Number:87616-84-0

Place of Origin:China

TOP Ghrp-6 99% purity Peptides Ghrp-6 for Weight Loss ​2mg/Vial 87616-84-0 Polypetide Hormones GHRP-6, also known as Releasing Hexapeptide, is a peptide hormone of the hormone class. As is with all related peptides, GHRP-6 is widely used to increase the...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Buy cheap CJC - 1295 muscle building peptides With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 product

Brand Name:Bodybuilding

Model Number:863288-34-0

Place of Origin:China

... With Dac , 2mg / Vial Fat Burning weight on powder 863288-34-0 Product Descripition: Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Buy cheap Legit Steroid Powder Finaplix H / Revalor H Trenbolone Acetate CAS NO.10161-34-9 for Muscle Building product

Brand Name:DW

Model Number:CAS: 10161-34-9

Place of Origin:China

... H Trenbolone Acetate 10161-34-9 for Muscle Building Email: joedoublewin@hotmail.com Skype: tonyself2000 Quick Details : Synonyms: Trenbolone acetate, Tren acetate, Revalor, finaplix, Tren ace CAS: 10161-34-9 Assays: Above 99% MOQ...

Doublewin Biological Technology Co., Ltd.
Verified Supplier

Guangxi

Buy cheap 99% Purity Raw Testosterone Steroids Powders Mesterolone for Bodybuilding CAS 1424-00-6 product

Brand Name:Kafen

Model Number:1424-00-6

Place of Origin:China

... Raw Steroid Powders Mesterolone for Bodybuilding Steroids CAS 1424-00-6 Basic Info. CAS: 1424-00-6 Synonyms: 17-beta-hydroxy-1-alpha-methyl-5-alpha-androstan-3-on; 1-alpha-methyl-17-beta-hydroxy-5-alpha-androstan...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Pharmaceutical Grade ingredient raw white powder Calcium Pyruvate  no 52009-14-0 product

Brand Name:Hongkong Saichuang

Model Number:Pharmaceutical ingredient

Place of Origin:China

... powder Calcium Pyruvate for weight loss no 52009-14-0 Quick Detail: Product Name Calcium pyruvate Synonym Pyruvic acid Calcium salt; Pyruvic acid calcium 52009-14-0 MF C6H6CaO6 MW 214.19 EINECS...

Hongkong  Saichuang  Pharmaceutical  Technology  Co.,Ltd
Verified Supplier

Hubei

Buy cheap Formestane Anti Estrogen Steroid Raw Powder Lentaron anti estrogen bodybuilding product

Brand Name:YUANYANG

Model Number:566-48-3

Place of Origin:China

... Lentaron With Fast And Safe Delivery Formestane CAS:566-48-3 MF:C19H26O3 MW:302.41 Synonyms:4-hydroxy-androst-4-ene-17-dione ;4-hydroxy-delta(sub4)-androstenedione ;4-HYDROXYANDROST-4-ENE-3,17-DIONE;4-HYDROXYANDROSTENEDIONE;4-HYDROXY...

Zhongshan Yuanyang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 product

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

... No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, Neorelin, Modified Sermorelin CJC-1295...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Buy cheap Human Growth Peptides HGH Fragment 176-191 Powder 2mg/Vial CAS 221231-10-3 product

Brand Name:Pharmlab

Model Number:CAS : 221231-10-3

Place of Origin:China

... Fragment 176-191 Powder 2mg/Vial CAS 221231-10-3 Basic Info Name: HGH 176-191 Synonyms :HGH FRAG 176-191,fragment 176 CAS:221231-10-3 Molecular :Formula C78H125N23O23S2 Molecular Weight :1817...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap CAS 432 60 0 Oral Progesterone Steroid Oral Allylestrenol Prevent Threatened Miscarriage product

Model Number:432-60-0

Place of Origin:China

CAS 432-60-0 Oral Anabolic Steroids Progesterone Oral Allylestrenol Prevent Threatened Miscarriage Highly Effective Natural Progesterone Hormone Allylestrenol for Protecting Pregnant Woman Pregnenolone (3β-hydroxypregn-5-en-20-one), also known as P5, is ...

Hongyu Chemical Co.,Ltd.
Verified Supplier

Hubei

Buy cheap Nm 2201 Pharmaceuticals Api Intermediates Cas1616253-26-9  Cannabinoids product

Brand Name:nM2201

Model Number:CasNo: 1616253-26-9

Place of Origin:China

nm2201 Pharmaceutical Intermediate CasNo: 1616253-26-9 Cannabinoids MB-2201 Powder 99.9% purity MMB2201 Basic info.: NM-2201 NM-2201 NM 2201 NM2201 Product information Warning: This product is not for human or veterinary use, is only provided as the ...

Linyi dingsheng chemical products Co., Ltd
Verified Supplier

Shandong

Buy cheap Testosterone Enanthate Test En Injectble Raw Steroid Powders 250mg/ml Muscle And Strength Gain product

Brand Name:TaiGui

Model Number:Skype:lujun688

Place of Origin:China

... Injectble Steroids Pharma Raw Materials 250mg/ml Testosterone enanthate quick detail: Product name: Testosterone enanthate Synonym: Testosterone heptanoate;Atlatest;Androtardyl;Andro L.A. 200;17b-Hydroxyandrost-4-en-3-one-17-ethanate CAS No.: 315...

Shanghai Taigui Pharmaceutical Technology Co., Ltd
Verified Supplier

Shanghai

Buy cheap Looks Synonymous With Clay Roof Tile Bamboo Synthetic Resin Roof Tile product

Categories:Color Steel Roof Tile

Country/Region:china

...Looks Synonymous With Clay Roof Tile Bamboo Synthetic Resin Roof Tile Large Image Looks Synonymous With Clay Roof Tile Bamboo Synthetic Resin Roof Tile Product Details: Place of Origin: China ...

Foshan Nanhai Yiquan Plastic Building Material Co.,Ltd.
ICP Remarked Supplier

Buy cheap Synonyms Iron III chloride hexahydrate product

Categories:Casting Iron

Telephone:86-029-88514362

Country/Region:china

Synonyms Iron III chloride hexahydrate Unit Price: USD 20.0000 / Bag/Bags Payment Type: T/T Incoterm: FOB,CIF Min. Order: 1 Bag/Bags Delivery Time: 15 Days Contact Now Add to Basket Share to: Synonyms Iron III chloride hexahydrate

Xi'an blue light fine materials Co. Ltd.
ICP Remarked Supplier

Buy cheap estradiol cypionate Synonyms:depofemin,estradiol;cypionate  CAS:313-06-4 product

Place of Origin:china

Brand Name:YC

Model Number:313-06-4

...estradiol cypionate Synonyms:depofemin,estradiol;cypionate CAS:313-06-4 MF:C26H36O3 MW:396.56 EINECS:206-237-8 Our ...

Wuhan Yuancheng Gongchuang Technology Co.,Ltd
Site Member

Hubei

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request