Sign In | Join Free | My xxjcy.com
xxjcy.com
Products
Search by Category
Home > Chemicals > Surfactants >

Sermorelin Acetate Side Effects

sermorelin acetate side effects

All sermorelin acetate side effects wholesalers & sermorelin acetate side effects manufacturers come from members. We doesn't provide sermorelin acetate side effects products or service, please contact them directly and verify their companies info carefully.

Total 9954 products from sermorelin acetate side effects Manufactures & Suppliers
Buy cheap Teriparatide Acetate Polypeptide Hormones Series CAS 52232-67-4 2.0% Single Impurity product

Brand Name:YUANHANG

Model Number:52232-67-4

Place of Origin:CHINA

...Raw Material Polypeptide Hormones Series Teriparatide Acetate for Mass Strengthen 52232-67-4 Abstract CAS:52232-67-4 MF:C172H278N52O47S2 MW:3890.49792 EINECS:...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Buy cheap Sermorelin Acetate CAS 86168-78-7 Polypeptides Pharmaceutical Hormone for Body Building product

Brand Name:SD

Model Number:99%

Place of Origin:shenzhen,china

...Product Description Quick Details of Sermorelin Product name Sermorelin Other Name SERMORELIN;SERMORELIN ACETATE;GH RELEASING FACTOR (1-29), AMIDE, GRF (1-29) NH2 Original China CAS 86168-78-7 Molecular formula ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Buy cheap Sermorelin GRF 1-29 Human Growth Hormone Sermorelin Acetate for weight loss product

Brand Name:steriodshow

Model Number:86168-78-7

Place of Origin:china manufactuer

... Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate 2. Description:

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Buy cheap Pharmaceutical Powder Polypeptides For Muscle Building Sermorelin Acetate Hydrate product

Brand Name:YIHAN

Model Number:Sermorelin

Place of Origin:hina

... Building Sermorelin Acetate Hydrate Quick detail Sermorelin 2mg (GRF 1-29) Peptide Molecular formula: C149H246N44O42S Molar Mass: 3357.96 CAS number: 86168-78-7 PubChem: CID 16133753 Synonyms: Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin Acetate...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Buy cheap 2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder product

Brand Name:Muscle Man

Model Number:400

Place of Origin:Hunan,China

...2MG / Vial Sermorelin Acetate Cas 86168-78-7 White Lyophilized Powder Protein Peptide Hormones Quick Detail; Alias:Sermorelin Acetate Hydrate CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.96 Purity: 99% Specification: 2mg/vial Appearance: ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Buy cheap 99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning product

Brand Name:HongKong Blue

Model Number:CAS No.: 86168-78-7

Place of Origin:CHINA

...99% Purity Anti-aging Bulking Cycle Human Peptides Sermorelin Acetate With 2mg/vial for Muscle Gainning Welcome inquiry and order samples, special gift is ready ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Buy cheap Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder product

Brand Name:Sermorelin

Model Number:87616-84-0

Place of Origin:china

...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Buy cheap White Powder Releasing Human Growth Peptides Sermorelin Acetate GRF 1-29 product

Brand Name:Yuancheng

Model Number:86168-78-7

Place of Origin:WUHAN

... Peptide Sermorelin Acetate GRF 1-29 Product Name:Sermorelin Acetate,GRF 1-29 Alias:Somatoliberin,Sermorelin ,Sermorelinum,Sermorelina,Sermoreline CAS No.: 86168-78-7 Molecular Formula: C149H246N44O42S Sermorelin Molecular Weight: 3357.96 Sermorelin Purity...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Buy cheap Sermorelin Acetate Bodybuilding , Growth Hormone Peptides Sample Available product

Brand Name:HBYC

Model Number:HBYC

Place of Origin:China

...High Purity and 2016 Newly Produced Sermorelin Improving Sleep Basic Info Port: China Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Buy cheap Effective Weight Loss Drug Orlistat CAS 96829-58-2 Fermented and Synthesis product

Brand Name:shinrezing

Model Number:96829-58-2

Place of Origin:China

Product Description Description Orlistat CAS:96829-58-2 Molecular formula: C29H53NO5 Molecular weight: 495.7348 Assay: 99.6% Boiling point: 615.9°C at 760 mmHg Flash point: 326.3°C Appearance: Off white powder Description: Orlistat (also known as ...

Hubei Shinrezing Pharmaceutical Technology Co.,Ltd
Verified Supplier

Hubei

Buy cheap Effective Anti Estrogen Steroids Hormones Exemestane Acatate 107868-30-4 For Breast Cancer product

Brand Name:TJ

Model Number:107868-30-4

Place of Origin:CHINA

...-4 for Breast Cancer Name: Exemestane CAS NO: 107868-30-4 Assay: 99% Appearance: White Crystalline Powder Effective Anti Estrogen Steroids Hormones Exemestane Acatate 107868-30-4 for Breast Cancer Quick Detail: Product Name...

zhuhai TianJian Chemical Co.,Ltd.
Verified Supplier

Guangdong

Buy cheap CAS 56-95-1 Chlorhexidine acetate white powder 99% with safe deliver Broad spectrum antibiotic product

Brand Name:jnom

Model Number:Medical level

Place of Origin:China

..., China Email:ycsale11@chembj.com Tele:+8615315573717 Skype:Nymeria Zhao product introduce: Product Name:Chlorhexidine acetate Synonym:hlorhexidine diacetate hydrate,Chlorhex,Hibitane CAS: 56-95-1 MF: C26H38Cl2N10O4 MW: 625.55 EINECS...

Jinan Oumi Biological Technology Co., Ltd
Active Member

Buy cheap Injectable Growth Hormone Muscle Buildig Peptides  Sermorelin Acetate 2mg/vial product

Brand Name:Shuangbojie

Model Number:Sermorelin Acetate

Place of Origin:China

... Hormone Sermorelin 2mg Sermorelin Acetate Sermorelin acetate is a human growth hormone-releasing hormone (GHRH or GRF) used for diagnostic evaluation of pituitary function and also for increasing growth in children. Off label usage of sermorelin acetate...

Zhuhaishi Shuangbojie Technology Co., Ltd
Active Member

Guangdong

Buy cheap Strength Enhancement Peptide Hormones Bodybuilding Sermorelin Acetate product

Brand Name:wumeitech

Model Number:86168-78-7

Place of Origin:China

... Hormones Bodybuilding Sermorelin Acetate Sermorelin Details: Sermorelin Spefication 2mg/vial Sermorelin Synonyms Sermorelin acetate hydrate, GRF 1-29 NH2 Sermorelin CAS No. 86168-78-7 Sermorelin M F C149H246N44O42S Sermorelin M W 3357.88 Sermorelin Usage...

Zhuhai Wumei Technology Co.,ltd.
Active Member

Guangdong

Buy cheap Sermorelin Acetate Powder product

Place of Origin:China

... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human...

Wuhan changdashun Technology Co., Ltd
Site Member

Hubei

Buy cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee product

Brand Name:Youngshe

Model Number:YSPI

Place of Origin:Chengdu , China

...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known ...

Chengdu Youngshe Chemical Company
Active Member

Buy cheap Sermorelin Acetate product

Brand Name:YC

Place of Origin:wuhan china

...Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

Wuhan Yuancheng Gongchuang Technology Co.,Ltd
Active Member

Hubei

Buy cheap High Purity Raw Powder Sermorelin Acetate Peptide for Weight Loss CAS:86168-78-7 product

Brand Name:JNJG

Model Number:86168-78-7

Place of Origin:CHINA

...Specification: Product Name Sermorelin Sermorelin CAS 86168-78-7 Sermorelin Alias Sermorelin Acetate Sermorelin Molecular Formula C149H246N44O42S Sermorelin Molecular weight 3357.96 Specification 2mg/vial Apperance white powder Assay 98% Storage 2-8 degree...

Jinan  Jiage  Biological Technology Co.,Ltd
Active Member

Shandong

Buy cheap Anabolic Steroids Sermorelin Bodybuilding , Sermorelin Acetate 2mg White Powder Peptide product

Place of Origin:China

...Anabolic Steroids Sermorelin Bodybuilding Sermorelin Acetate 2mg White Powder Peptide Product Data: Product name: Sermorelin Sequence: Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Buy cheap Sermorelin Acetate Hydrate Increase Human Growth Hormone In Sport GHRH product

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... In Sport GHRH Sermorelin Sermorelin Acetate, also known as GRF 1-29, is a Growth Hormone Releasing Hormone (GHRP) produced by the brain that stimulates the production and release of Growth Hormone (GH). Sermorelin Acetate was first...

Hongkong Kangdisen Medical Co., Limited
Active Member

Hong Kong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request