Sign In | Join Free | My xxjcy.com
xxjcy.com
Products
Search by Category
Home > Chemicals > Basic Organic Chemicals > Organic Salt >

Sermorelin Acetate Powder

sermorelin acetate powder

All sermorelin acetate powder wholesalers & sermorelin acetate powder manufacturers come from members. We doesn't provide sermorelin acetate powder products or service, please contact them directly and verify their companies info carefully.

Total 380 products from sermorelin acetate powder Manufactures & Suppliers
Buy cheap Bio Pharmaceutical Peptides , Sermorelin Acetate 3357.96 Molecular Weight product

Brand Name:Filter

Place of Origin:Shanghai

Model Number:CAS No:87616-84-0

...98% High purity Lab Supply Pharmaceutical Peptide Sermorelin Acetate Product Description Product Name:Sermorelin Specification:2mg/vial ,10vial/box CAS No:87616-84-0 Specifications:2mg/vial,5mg/Vial, 10vial/...

Zhengzhou Filter Biotechnology Co.,Ltd
Verified Supplier

Henan

Buy cheap CAS 87616-84-0 Sermorelin Acetate Bodybuilding Peptides Medicine Grade product

Brand Name:Filter

Place of Origin:Shanghai

Model Number:CAS No:87616-84-0

...98% High purity Lab Supply Pharmaceutical Peptide Sermorelin Acetate Product Description Product Name:Sermorelin Specification:2mg/vial ,10vial/box CAS No:87616-84-0 Specifications:2mg/vial,5mg/Vial, 10vial/...

Passion Technology Development Limited
Verified Supplier

Buy cheap Anti Wrinkle Blue Organic Herbal Powders Copper Peptide Polypeptide GHK - CU Powder product

Brand Name:BIOF

Model Number:49557-75-7

Place of Origin:Xi'an , China

...Anti Wrinkle Blue Powder Copper Peptide Polypeptide GHK - CU Powder For Skin Care What Is Copper Peptide ? Copper is an important trace element that has ...

Xi'an Biof Bio-technology Co.,Ltd
Verified Supplier

Buy cheap Sermorelin Acetate Powder product

Place of Origin:China

... purity Atosiban Acetate Deslorelin Acetate Desmopressin Acetate Gonadorelin Acetate/GnRH Leuprorelin Acetate Melanotan ② Octreotide Acetate Oxytocin Acetate Salmon Calcitonin Sermorelin Acetate Teriparetide Acetate Triptorelin Acetate Thymosinβ4(human...

Wuhan changdashun Technology Co., Ltd
Active Member

Hubei

Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product

Categories:API(Active Pharmaceutical Ingredients)

Country/Region:china

... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe...

Shenzhen YoungCom Biotech Co., Ltd.
Site Member

Guangdong

Buy cheap Sermorelin Acetate 99.0% bulk powder cas 86168-78-7 product

Categories:API(Active Pharmaceutical Ingredients)

Telephone:86-755-26879710

Country/Region:china

... export packing with safe shipment Delivery Detail: imm. shipment Specifications Sermorelin Acetate 99.0%min. safe shipment Product Name Sermorelin Sermorelin Acetate 99.0%min. Product Name Sermorelin Acetate Cas No. 86168-78-7 Purity (HPLC) 99.0%min. safe...

Shenzhen YoungCom Biotech Co., Ltd.
Site Member

Guangdong

Buy cheap Sermorelin Acetate product

Categories:Peptide CJC 1295

Telephone:86-027-50755978

Country/Region:china

...Sermorelin Acetate CAS : 86168-78-7 MF : C149H246N44O42S Spec : USP28/BP2003 Color : White Crystalline Powder Brand : YC Detail Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val...

HUBEI YUANCHENG SAICHUANG TECHNOLOGY CO. LTD
ICP Remarked Supplier

Buy cheap Sermorelin Acetate product

Categories:Peptide Powder

Telephone:+86 592 5365887

Country/Region:china

... have already purchased Sermorelin Acetate.] <Acetate | Listing | Leuprorelin Acetate>> [Products Name] Sermorelin Acetate [Molecular Formula] C149H246N44O42 [CAS No.]86168-78-7 [Product Description] Appearance :White powder Specific Optical...

Green Stone Switzerland Co., Ltd
ICP Remarked Supplier

Buy cheap Sermorelin Acetate product

Place of Origin:chengdu,china

...Octreotide Acetate Sermorelin Acetate Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

ChengDu Teddy Bio-Technology Co.,LTD
Active Member

Sichuan

Buy cheap Manufacture fresh stock Sermorelin Acetate with competitve price anf quality guarantee product

Brand Name:Youngshe

Model Number:YSPI

Place of Origin:Chengdu , China

...Product Description Name: Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-...

Chengdu Youngshe Chemical Company
Active Member

Buy cheap Sermorelin Acetate product

Place of Origin:china

...Product Description Sermorelin AcetateProduct Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

Chengdu Taidi Bio-Pharm Co.,Ltd
Active Member

Sichuan

Buy cheap Sermorelin Acetate product

Place of Origin:China

Model Number:CAS No.:86168-78-7

...Sermorelin Acetate 2mg/vial Molecular Formula:C149H246N44O42 Molecular Weight:3358.03 CAS No.:86168-78-7 Sequence: SPECIFICATIONS: 1.Appearance :White powder 2.Specific Optical Rotation(c=0.5,1%HAc) :-80.0~-90.0° 3.Water Content(Karl Fischer) :≤6.0% 4....

Chengdu Kaijie Biopharm Co. Ltd.
Active Member

Sichuan

Buy cheap Peptide synthesis  API powder Sermorelin Acetate CAS  86168-78-7 product

Brand Name:Youngshe Peptide

Model Number:CAS 86168-78-7

Place of Origin:China

...Sermorelin Acetate Cas No: 86168-78-7(net),114466-38-5(acetate) Formula: C151H250N44O44S Molecular:3417 Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQ Purity:98% Appearance: white powder Source: synthetic Also known as: Geref, UNII-00IBG87IQW,AN-33322,GRF(1-29),...

Chengdu youngshe chemical Co,.Ltd
Active Member

Buy cheap Sermorelin Acetate product

Place of Origin:China

Brand Name:GLS

...-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity(HPLC):98.0%min. Cat #:61712 Appearance:White powder CAS.NO:114466-38-5 MSDS:MSDS Single Impurity(HPLC): Mass balance: Peptide Content(N%): Water content...

GL Biochem (Shanghai) Ltd
Active Member

Shanghai

Buy cheap Sermorelin Acetate product

Place of Origin:china

Model Number:Cas NO:86168-78-7

...:3358.03 CAS No.:86168-78-7 Sequence: SPECIFICATIONS: 1.Appearance :White powder 2.Specific Optical Rotation(c=0.5,1%HAc) :-80.0~-90.0° 3.Water Content(Karl Fischer) :≤6.0% 4.Acetate Content(by HPLC) :≤15.0% 5.Amino Acid Composition :±10% of...

Chengdu Kaijie Biopharm Co. Ltd.
Active Member

Chengdu

Buy cheap Sermorelin Acetate product

Place of Origin:china

...SPECIFICATIONS: 1.Appearance :White powder 2.Specific Optical Rotation(c=0.5,1%HAc) :-80.0~-90.0° 3.Water Content(Karl Fischer) :≤6.0% 4.Acetate Content(by HPLC) :≤15.0% 5.Amino Acid Composition :±10% of theoretical 6.Purity(by HPLC) :≥98.0% 7....

Chengdu Kaijie Biopharm Co. Ltd
Active Member

Chengdu

Buy cheap Sermorelin Acetate product

Place of Origin:China

...Name: Sermorelin Acetate 中文名:醋酸舍莫瑞林 category : Pharmaceutical Peptide Product Data Sheet Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-...

GL Biochem shanghai ltd.
Active Member

Shanghai,

Buy cheap Sermorelin Acetate product

Place of Origin:China

...Product Description Sermorelin Acetate : CAS NO.:86168-78-7; Specification: 1.Appearance :White powder ; 2.Specific Optical Rotation(c=0.5,1%HAc) :-80.0~-90.0° ; 3.Water Content(Karl Fischer) :≤6.0% ; 4.Acetate Content(by HPLC) :≤15.0% ; 5.Amino Acid ...

Shanghai hongbang Medical Technology CO., Ltd
Active Member

Shanghai

Buy cheap Sermorelin Acetate product

Place of Origin:China

Model Number:114466-38-5

Product Name: Sermorelin Acetate Molecular Structure CAS No.: 114466-38-5 Molecular Formula: C149H246N44O42S Molecular Weight: 3357.91 Purity (HPLC): 98% Appearance: White powder

Gingi Industrial Limited
Active Member

Shanghai

Buy cheap Sermorelin Acetate;   Thymopentin ;  Argireline Acetate product

Place of Origin:china

1. CAS NO.:86168-78-7; Appearance :Whitepowder SpecificOpticalRotation(c=0.5,1%HAc) :-80.0~-90.0degree WaterContent(KarlFischer):6.0%Max AcetateContent(byHPLC):15.0%Max AminoAcidComposition :around10%oftheoretical Purity(byHPLC) :98.0%min SingleImpurity(...

Shanghai Hanhong Chemical CO., Ltd
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request